Protein Info for LRK53_RS12170 in Rhodanobacter sp000427505 FW510-R12

Annotation: sulfate ABC transporter permease subunit CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 63 to 89 (27 residues), see Phobius details amino acids 101 to 126 (26 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 201 to 227 (27 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 20 to 275 (256 residues), 401.3 bits, see alignment E=1.9e-124 TIGR00969: sulfate ABC transporter, permease protein" amino acids 23 to 274 (252 residues), 324 bits, see alignment E=7.9e-101 PF00528: BPD_transp_1" amino acids 80 to 276 (197 residues), 46.3 bits, see alignment E=2.1e-16

Best Hits

Swiss-Prot: 53% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 74% identity to rpi:Rpic_1222)

MetaCyc: 53% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>LRK53_RS12170 sulfate ABC transporter permease subunit CysW (Rhodanobacter sp000427505 FW510-R12)
MNAPRHSPRRGTGRRLGHALIIVSASLFLGVFLLLPLASVFVEAFRQGAHAYLTSLHQPE
ALAAIRLTLLVTVIAVPLNLVFGVAAAWAMTRFEFRGKAALGALIDLPFSVSPVISGLIY
VLLFGAQGWFGPWLVAHGIRVIFAVPGLVLATVFITLPFVARELIPLMQAQGSEEEEAAR
ILGANGWQLFLRVTLPNIRWALLYGVLLCNARAMGEFGAVSVVSGHIRGLTTTLPLEVEM
RYNEYDYVGAFAVASLLALLALLTLALKALLEWRYRGELAAHAPGGH