Protein Info for LRK53_RS11860 in Rhodanobacter sp000427505 FW510-R12

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 121 to 138 (18 residues), see Phobius details amino acids 148 to 166 (19 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF00892: EamA" amino acids 149 to 278 (130 residues), 70.6 bits, see alignment E=8.4e-24

Best Hits

KEGG orthology group: None (inferred from 64% identity to pmk:MDS_2248)

Predicted SEED Role

"Putative DMT superfamily metabolite efflux protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (294 amino acids)

>LRK53_RS11860 EamA family transporter (Rhodanobacter sp000427505 FW510-R12)
MSPRSTVAPLALAVGMLLISMVSYQCGASLAKQLFPQVGAQGATAYRLGLSALILLLWRR
PWRRSAGRRDWAALWGYGLSMGAMNLVFYMSLRTIPLGIAVALEFTGPLALALFGSRRLL
DFVWIALVVAGLALLLPLRGQVNALDPVGVLYALAAGVGWALYIVLGKKAGAAHGADAVT
LGTTIGALLVIPFGIAHAGSALLSPALLPYALGVAVLSSALPYSLEMIALTRLPARTFST
LLSLEPAIAAVAGVALLGERPSVLQWLAIATIIVAAAGTALSVQRPALAEPLAN