Protein Info for LRK53_RS11735 in Rhodanobacter sp000427505 FW510-R12

Annotation: NADH-quinone oxidoreductase subunit NuoB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 PF01058: Oxidored_q6" amino acids 34 to 144 (111 residues), 104.8 bits, see alignment E=1.5e-34

Best Hits

Swiss-Prot: 45% identical to MBHJ_PYRFU: Probable membrane-bound hydrogenase subunit mbhJ (mbhJ) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 64% identity to slt:Slit_2559)

Predicted SEED Role

"Formate hydrogenlyase subunit 7" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>LRK53_RS11735 NADH-quinone oxidoreductase subunit NuoB (Rhodanobacter sp000427505 FW510-R12)
MPDTDETASTAIQRELHAVFGRALCIRHVDAGSCNGCELEIHALSNAYYNLEGAGIRFVA
SPRHADLLLVTGPVSVNMEDALRQTYEAMPDPKWVLAVGDCAACGGLFGANYATRGPVSA
IIPVDAVVAGCPPTPLAIMRGLLQITSKRPA