Protein Info for LRK53_RS11580 in Rhodanobacter sp000427505 FW510-R12
Annotation: bifunctional enoyl-CoA hydratase/phosphate acetyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00625, phosphate acetyltransferase [EC: 2.3.1.8] (inferred from 68% identity to rpf:Rpic12D_4426)Predicted SEED Role
"Phosphate acetyltransferase (EC 2.3.1.8)" in subsystem Ethanolamine utilization or Fermentations: Lactate or Fermentations: Mixed acid or MLST or Propanediol utilization or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Threonine anaerobic catabolism gene cluster (EC 2.3.1.8)
MetaCyc Pathways
- heterolactic fermentation (16/18 steps found)
- mixed acid fermentation (13/16 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (15/19 steps found)
- superpathway of N-acetylneuraminate degradation (17/22 steps found)
- superpathway of L-threonine metabolism (14/18 steps found)
- pyruvate fermentation to acetate II (3/3 steps found)
- superpathway of acetate utilization and formation (3/3 steps found)
- L-threonine degradation I (5/6 steps found)
- acetate and ATP formation from acetyl-CoA I (2/2 steps found)
- (S)-propane-1,2-diol degradation (4/5 steps found)
- acetylene degradation (anaerobic) (4/5 steps found)
- ethanolamine utilization (4/5 steps found)
- pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
- pyruvate fermentation to acetate I (2/3 steps found)
- pyruvate fermentation to acetate IV (2/3 steps found)
- pyruvate fermentation to acetate VII (2/3 steps found)
- sulfoacetaldehyde degradation I (1/2 steps found)
- pyruvate fermentation to acetate and lactate II (2/4 steps found)
- acetyl-CoA fermentation to butanoate (4/7 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
- sulfolactate degradation II (1/4 steps found)
- methanogenesis from acetate (2/6 steps found)
- superpathway of sulfolactate degradation (2/6 steps found)
- superpathway of L-alanine fermentation (Stickland reaction) (4/9 steps found)
- superpathway of taurine degradation (1/6 steps found)
- lactate fermentation to acetate, CO2 and hydrogen (Desulfovibrionales) (2/8 steps found)
- L-lysine fermentation to acetate and butanoate (3/10 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
- gallate degradation III (anaerobic) (3/11 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
- purine nucleobases degradation II (anaerobic) (9/24 steps found)
- superpathway of methanogenesis (2/21 steps found)
- superpathway of L-lysine degradation (7/43 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.8
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (471 amino acids)
>LRK53_RS11580 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase (Rhodanobacter sp000427505 FW510-R12) MDETTPDTAAPLIRNRTFDEIALGDSATVERVLTAADVQLLATLYGDGDPQRLDPACAAS PAFHDMIGHGMWGVALIATALGTRLPGAGTTCLEQALRFHAPLHIGDTLAVQVQAIARDA ATRQIRFACRGVNQHGVLAIDGTVEVLAPAEHIEYAATRLPAVRLPDGDGRPLVARALAL GAIRVAVVHPCDETSLGAALDARAAGLIEPVLVAPQAKLAEVARQARLDLAGIAIEDVPH SHAAAARAVELAAGGRVDALMKGSLHTDELMAAVVASATGLRTARRISHCYLMHSPAYPR PFIITDGAVNIAPTLEEKADIVRNAIDLAHILGVTTPRVAILAAVETVNPRMQTTLDAAA LCKMADRGQITGAVLDGPLAFDNAISAAAARIKGIESNVAGLADILLVPDLESGNMLAKQ LEYLGGASSAAVVMGARVPIVLTSRADSRESRIASCALAALVAHRYRLSPP