Protein Info for LRK53_RS11100 in Rhodanobacter sp000427505 FW510-R12

Annotation: AarF/UbiB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 522 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 465 to 484 (20 residues), see Phobius details amino acids 491 to 514 (24 residues), see Phobius details PF03109: ABC1" amino acids 65 to 303 (239 residues), 204.4 bits, see alignment E=1.6e-64 PF27536: UbiB_N" amino acids 328 to 386 (59 residues), 29 bits, see alignment 6.7e-11

Best Hits

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 43% identity to npp:PP1Y_AT23459)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (522 amino acids)

>LRK53_RS11100 AarF/UbiB family protein (Rhodanobacter sp000427505 FW510-R12)
MQIAWAGLGLAWDALRWRRRAPERLPECVRVTLTRLGTTFIKLGQGLSLRWDLLPAAYRE
ALSHLHSDVPPFPSSQAAAAIDAAFGQPLSSLFSEFDPNPLAAASVAQIHRARLHDGREV
VVKITRPGIQAQVHADLRLLRRTARIAQVVWPPLRRQRPVELVDELSQFMHAEIDMRHEA
QNMRRMAPVLDPLPDVTLPHVIEPFAAREVLVQEMSHGQRLEAYYRTPQAPALAIALLDA
YLHQLFIAGVFHADPHPGNLFVLDDGRLCFHDFGSIGVLDPGARLALGSLVEAVVANDGA
DVLDAAIALGFFGPHIERRDHEREIHLILSELVGRPLAQWSVAEAIWRVARIGHGASFRL
PAHLLVLMRTLFLVENTLRALDPQFDMLGTLARRAPEIATAIDDASHTGQRPLAAQFART
ARQLPQLAADLLRQAQLNGGRPAFTIHHRGLVSTQEAIGRTGNRLALALVTLGLYVSGSL
LTLHGDGPRMFGHLPVLSVIAFVAAAVLSLRLIIGISRSGHL