Protein Info for LRK53_RS10995 in Rhodanobacter sp000427505 FW510-R12

Annotation: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00300: His_Phos_1" amino acids 5 to 198 (194 residues), 145.8 bits, see alignment E=6.9e-47 TIGR01258: phosphoglycerate mutase 1 family" amino acids 5 to 124 (120 residues), 136.4 bits, see alignment E=5.4e-44

Best Hits

Swiss-Prot: 58% identical to GPMA_METS4: 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (gpmA) from Methylobacterium sp. (strain 4-46)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 58% identity to mno:Mnod_0444)

Predicted SEED Role

"Phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>LRK53_RS10995 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (Rhodanobacter sp000427505 FW510-R12)
MGRYLTLVRHGQSTYNASNRFTGWLDPELTDQGVHEAHAVAEQLRGAELTFDIAFSSALH
RARRTARIILDDLQLKAMPVTMDFALDERNYGDMTGLDKDEARRRWGVDQVQHWRRSYAD
APPDGESLRDTVARVLPFYIQHILPAVMRGQAALVVAHGNSLRALVMALDGLSTQAVTQL
EVATGEVLVYELAADTTILSKRSLAMETPAKAPPAAATEDASTPPATS