Protein Info for LRK53_RS10985 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 31 to 55 (25 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details PF01569: PAP2" amino acids 72 to 174 (103 residues), 44.1 bits, see alignment E=8.4e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>LRK53_RS10985 phosphatase PAP2 family protein (Rhodanobacter sp000427505 FW510-R12)
MNALPDSNALWESWNVALFQHLHATSSSPHALIAVATVLAEWPLFVGAGVTGWQLLRQRD
RLGMVRLIAAGGMALLIEALVSALAFHPRPFAVGFGPAWVTHTANNSMPSTHVTLTLIMA
ITLAMRRQRWTSLVVVVLATMLAWARVYVGIHWPADMVGAALSAIVSVAVIYGLEWGITV
LMQRRKENAVARLRQEPELPVNTKRSPARQPTER