Protein Info for LRK53_RS10440 in Rhodanobacter sp000427505 FW510-R12

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 46 to 236 (191 residues), 122.4 bits, see alignment E=1e-39 PF16576: HlyD_D23" amino acids 46 to 238 (193 residues), 58.6 bits, see alignment E=8.5e-20 PF13533: Biotin_lipoyl_2" amino acids 47 to 92 (46 residues), 56.3 bits, see alignment 3.2e-19 PF13437: HlyD_3" amino acids 155 to 239 (85 residues), 54.3 bits, see alignment E=3.2e-18

Best Hits

Swiss-Prot: 41% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 60% identity to rme:Rmet_4791)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>LRK53_RS10440 HlyD family secretion protein (Rhodanobacter sp000427505 FW510-R12)
MKKIFKSLGPIMLTLVAVVIAAIVLKHLWHYYHDEPWTRDGHLRADVVQLAPDVSGLVTA
VEVDDNQPVHRGQPLFEIDRSRYELALNQARTAVEKATASLHQFQREALRNHALSDLVSK
EIVEEGRSKVAVAQAALDEAKNAVDLAQLNLQRTTVYSPVDGFVNDRTVRVGDYVNTGHP
VLSVVDSRSFHVDGYFEETKLSRIHIGQPVKIEVMGESQLLHGHVQSIAAGIEDRDRTPG
SNLLPDINPTFNWVRLAQRVPVRITLDGDPGDIRLIVGRTATVTVLPDNDATARPRQPAT
PAAPAATYPGVAPTTARSAP