Protein Info for LRK53_RS10270 in Rhodanobacter sp000427505 FW510-R12

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00561: Abhydrolase_1" amino acids 33 to 264 (232 residues), 125.1 bits, see alignment E=8e-40 PF12697: Abhydrolase_6" amino acids 34 to 270 (237 residues), 71.1 bits, see alignment E=4.6e-23 PF12146: Hydrolase_4" amino acids 61 to 263 (203 residues), 40.5 bits, see alignment E=4.2e-14

Best Hits

Swiss-Prot: 71% identical to DMPD_PSEUF: 2-hydroxymuconate semialdehyde hydrolase (dmpD) from Pseudomonas sp. (strain CF600)

KEGG orthology group: None (inferred from 71% identity to adk:Alide2_0281)

MetaCyc: 65% identical to 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase (Pseudomonas putida F1)
2-OH-6-OXOHEPTA-2-4-DIENOATE-HYDR-RXN [EC: 3.7.1.25]

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 3.7.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.25 or 3.7.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>LRK53_RS10270 alpha/beta fold hydrolase (Rhodanobacter sp000427505 FW510-R12)
MNAHSNPEIGQDIVAAGIRTNYHDLNRSAAGVPLLLIHGSGPGVSAFANWRPVMPTFAER
RRVVAPDMVGFGFTDRPAGYHYTMDNWVTHAIGVMDALKLPQVDLVGNSFGGALSLAVAV
RHPERVRRLVLMGAAGVPFKITPGLDEVWGYQPSFENMRKMMDLFAYDRALVTDELAELR
YRASIRPGFQESFSAMFPAPRQRGVDALCTPTADIRALPHETLVIHGREDQVLPLATSLT
LADWIPNAQLHVFGKCGHWTQIEHSARFARLVTDFLDEAA