Protein Info for LRK53_RS10270 in Rhodanobacter sp000427505 FW510-R12

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 33 to 264 (232 residues), 125.1 bits, E=8e-40
• PF12697: Abhydrolase_6
  • amino acids 34 to 270 (237 residues), 71.1 bits, E=4.6e-23
• PF12146: Hydrolase_4
  • amino acids 61 to 263 (203 residues), 40.5 bits, E=4.2e-14

Best Hits

Swiss-Prot: 71% identical to DMPD_PSEUF: 2-hydroxymuconate semialdehyde hydrolase (dmpD) from Pseudomonas sp. (strain CF600)

KEGG orthology group: None (inferred from 71% identity to adk:Alide2_0281)

MetaCyc: 65% identical to 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase (Pseudomonas putida F1)
2-OH-6-OXOHEPTA-2-4-DIENOATE-HYDR-RXN [EC: 3.7.1.25]

Predicted SEED Role

"2-hydroxymuconic semialdehyde hydrolase (EC 3.7.1.9)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 3.7.1.9)

MetaCyc Pathways

• toluene degradation I (aerobic) (via o-cresol) (7/7 steps found)
• catechol degradation I (meta-cleavage pathway) (5/5 steps found)
• toluene degradation to 2-hydroxypentadienoate I (via o-cresol) (4/4 steps found)
• catechol degradation to 2-hydroxypentadienoate I (2/2 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (5/7 steps found)
• 2-nitrotoluene degradation (2/3 steps found)
• meta cleavage pathway of aromatic compounds (7/10 steps found)
• toluene degradation to 2-hydroxypentadienoate (via toluene-cis-diol) (2/4 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
• toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.25 or 3.7.1.9

Protein Sequence (280 amino acids)

>LRK53_RS10270 alpha/beta fold hydrolase (Rhodanobacter sp000427505 FW510-R12)
MNAHSNPEIGQDIVAAGIRTNYHDLNRSAAGVPLLLIHGSGPGVSAFANWRPVMPTFAER
RRVVAPDMVGFGFTDRPAGYHYTMDNWVTHAIGVMDALKLPQVDLVGNSFGGALSLAVAV
RHPERVRRLVLMGAAGVPFKITPGLDEVWGYQPSFENMRKMMDLFAYDRALVTDELAELR
YRASIRPGFQESFSAMFPAPRQRGVDALCTPTADIRALPHETLVIHGREDQVLPLATSLT
LADWIPNAQLHVFGKCGHWTQIEHSARFARLVTDFLDEAA