Protein Info for LRK53_RS10205 in Rhodanobacter sp000427505 FW510-R12

Annotation: SulP family inorganic anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 318 to 338 (21 residues), see Phobius details amino acids 350 to 380 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 15 to 144 (130 residues), 103.7 bits, see alignment E=1e-33 amino acids 159 to 355 (197 residues), 103.7 bits, see alignment E=9.8e-34 PF01740: STAS" amino acids 395 to 483 (89 residues), 37.3 bits, see alignment E=2.1e-13

Best Hits

Swiss-Prot: 58% identical to YBAR_BACSU: Putative sulfate transporter YbaR (ybaR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 72% identity to rme:Rmet_4472)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (493 amino acids)

>LRK53_RS10205 SulP family inorganic anion transporter (Rhodanobacter sp000427505 FW510-R12)
MTLRNLRQEWFSNIRGDVLAGIVVALALIPEAIAFSIIAGVDPKVGLYAAFCIATTVAFV
GGRPGMISGATGAMALLMVTLVKDHGLQYLLAATMLTGVLQILAGVFKLGVLMRFVSRSV
ITGFVNALAILIFMAQLPELAGGDWRVYALVVAGLIIIYGVPRFTKVIPSPLICIIVLTL
FTVLAGVHVRTVADMGTLPTSLPTFLSPQVPFNWHTLMVVLPYSATMAVVGLLESMMTAS
IVDEFTDTSSNKSRECIGQGTANIVASLFGGMAGCAMIGQSVINVKSGGRGRLSTFCAGV
FLLIMVVFASRWVGQIPMAALVAVMIMVSIGTFSWSSIKNLKLHPKSSSVVMIATVVVVV
ATHDLSKGVIVGVLLSALFFARKVGRVLHVGSALNTDERIREYRVTGQVFFASAETFIAA
FDFREALDQVRIDVSRAHFWDLTAVSALDKVVLKFRREGTMVDIHGLNEASATIVDRLAI
HDKPDAVESLMGH