Protein Info for LRK53_RS10110 in Rhodanobacter sp000427505 FW510-R12

Annotation: chromate resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF20229: ChrB_N" amino acids 23 to 102 (80 residues), 25.9 bits, see alignment E=8.5e-10 PF09828: ChrB_C" amino acids 185 to 314 (130 residues), 141.4 bits, see alignment E=2.3e-45

Best Hits

Swiss-Prot: 50% identical to CHRB1_CUPMC: Protein ChrB (chrB1) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: None (inferred from 51% identity to rso:RSp0554)

Predicted SEED Role

"Chromate resistance protein ChrB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>LRK53_RS10110 chromate resistance protein (Rhodanobacter sp000427505 FW510-R12)
MKTNPSPWLMLVVSLPGRSQTPRMRLWRALKGAGAEALRDGVYVLPDNTSARDLFQAQAE
EVMRIGGIAQIVPFHATDATQEAQLRGAFDRSALYAEGLEQLSMVMVELPGLAENEARRR
LAAARRAVEGVVAVDFFPGKARDHAETALRDAEQTLNGQFAQDEPHAAHGLIARRNAAEY
RARLWATRKHLWIDRVASAWLIRRFIDPDARFLWLDQPADCPADALGFDFDGATFTHVGA
RVSFEVLVTSFDLDRNAGLARLGRLIHYLDIGGVPAADAAGFASVMAGARSRRGNDDDGL
LQDMTTVLDCLYAAYLDPPGESP