Protein Info for LRK53_RS10055 in Rhodanobacter sp000427505 FW510-R12

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 63 to 86 (24 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details PF07681: DoxX" amino acids 27 to 108 (82 residues), 52.8 bits, see alignment E=2.6e-18

Best Hits

Predicted SEED Role

"INTEGRAL MEMBRANE PROTEIN (Rhomboid family)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>LRK53_RS10055 DoxX family protein (Rhodanobacter sp000427505 FW510-R12)
MNKLLWRTSGYYRQLAEALSSLGPVVLLLFRVWVALAFWRAGVVKLDDPAGTSYLFNNEY
HVPLLSGDAAAFLGTWIELVAPWFLLLGLGGRLTAGFLFIYNIMAVVSYPDLWPHGFWAG
LVGNDFSDHKVWAMMLLAVIAWGPGPFSLDRILERLRPAARRGDGADTAVRAG