Protein Info for LRK53_RS09930 in Rhodanobacter sp000427505 FW510-R12

Annotation: mercuric ion transporter MerT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 116 signal peptide" amino acids 9 to 11 (3 residues), see Phobius details transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details PF02411: MerT" amino acids 1 to 116 (116 residues), 197.3 bits, see alignment E=3.1e-63

Best Hits

Swiss-Prot: 84% identical to MERT_ALCSP: Mercuric transport protein MerT (merT) from Alcaligenes sp.

KEGG orthology group: None (inferred from 84% identity to adk:Alide2_3380)

Predicted SEED Role

"Mercuric transport protein, MerT" in subsystem Mercury resistance operon

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (116 amino acids)

>LRK53_RS09930 mercuric ion transporter MerT (Rhodanobacter sp000427505 FW510-R12)
MSAPKKPSGVLVAGGLAAILASTCCLGPLLLVALGFSGAWIGNLTVLEPYRPWFIGLALV
AMFFAWRRIFRPATACQPGEVCAIPQVRTTYKLIFWIVAALVLVALGFPYVLPLFY