Protein Info for LRK53_RS09885 in Rhodanobacter sp000427505 FW510-R12

Annotation: cell division protein ZipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details TIGR02205: cell division protein ZipA" amino acids 19 to 312 (294 residues), 195.6 bits, see alignment E=9.5e-62 PF04354: ZipA_C" amino acids 185 to 311 (127 residues), 137.1 bits, see alignment E=1.6e-44

Best Hits

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>LRK53_RS09885 cell division protein ZipA (Rhodanobacter sp000427505 FW510-R12)
MTLQPVLAFAWNPAVGIPMLIVGVIVLALIWLFGQPKKEQGRRRAMPEPHAGERREPTLG
GPGSEPGAGEPFIGDTQPQQGELDVGLREELERLGATLSGERAKAPMPAAPKARSRQQPK
LADHVASIIDALRAPSSGEPAAPDALPAAEEPALPAQAPVAAPAAVAPPRSELGRRPAQL
PVERIVTLFVVARDNGRFHGPDLVVAAEKAGLEFGDMGIYHRLVDGKRELGPIFSVANML
KPGNFDLARLDALRTPGVSFFMTLPAPLPALDAWDAMLPTAQRLAELLDGQVLDEERNAL
GRQRIAHIRDQLRGWDRDHEGKEIIFGR