Protein Info for LRK53_RS09805 in Rhodanobacter sp000427505 FW510-R12

Annotation: TraB/GumN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 273 to 291 (19 residues), see Phobius details amino acids 302 to 332 (31 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details PF01963: TraB_PrgY_gumN" amino acids 22 to 250 (229 residues), 97.3 bits, see alignment E=7.1e-32 TIGR00261: TraB family protein" amino acids 30 to 406 (377 residues), 268.6 bits, see alignment E=4.3e-84

Best Hits

KEGG orthology group: None (inferred from 52% identity to tkm:TK90_2345)

Predicted SEED Role

"Pheromone shutdown protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>LRK53_RS09805 TraB/GumN family protein (Rhodanobacter sp000427505 FW510-R12)
MSAPETEVTALPAALQGQPIERVQHDGVEYVVLGTAHVSRSSMEAVEALLDHEHFDAVAV
ELCDSRAQSMRDPEAFKQMDLFKVIRQGKAGMVAASLVLSTFQKRLADQSGIQPGAEMKA
AMDGAEARGLPLWLIDREVGTTLKRAWRSVGFWQRFGLLGGLLASVFEREDIEQSEIEKL
KQGDLLESAFSEFASSSKPLYDSLIGERDAFMAARLREEAARAATTEHRRVLVVIGAGHL
KGLCTQLREQQDDPAARVAELAVPPPKARWPKWVAAGLVLLVFAAIIWAFHRNASLGTQA
LMAWVLFTGGFAALGALVAGGHPLSVVAAFIAAPIKPFRPGIPAGGISAMAEAWARHPRV
VDFDTLRDDIVHWSGWWKNRVARTLLNFFLVSVGTIVGEYSAGIHIFKSLF