Protein Info for LRK53_RS09770 in Rhodanobacter sp000427505 FW510-R12

Annotation: excinuclease ABC subunit UvrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 TIGR00194: excinuclease ABC subunit C" amino acids 15 to 592 (578 residues), 601.8 bits, see alignment E=7.3e-185 PF01541: GIY-YIG" amino acids 22 to 97 (76 residues), 35.2 bits, see alignment E=3.7e-12 PF27096: UvrC_M" amino acids 106 to 201 (96 residues), 94.9 bits, see alignment E=1e-30 PF02151: UVR" amino acids 209 to 242 (34 residues), 39.6 bits, see alignment (E = 9.1e-14) PF22920: UvrC_RNaseH" amino acids 255 to 368 (114 residues), 118.9 bits, see alignment E=3.4e-38 PF08459: UvrC_RNaseH_dom" amino acids 384 to 545 (162 residues), 176.9 bits, see alignment E=8.2e-56 PF14520: HHH_5" amino acids 561 to 611 (51 residues), 31.8 bits, see alignment 4.9e-11

Best Hits

Swiss-Prot: 57% identical to UVRC_ALKEH: UvrABC system protein C (uvrC) from Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)

KEGG orthology group: K03703, excinuclease ABC subunit C (inferred from 60% identity to psu:Psesu_1323)

MetaCyc: 52% identical to UvrABC excision nuclease subunit C (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit C" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (613 amino acids)

>LRK53_RS09770 excinuclease ABC subunit UvrC (Rhodanobacter sp000427505 FW510-R12)
MQSAQPPPFDGKAFVRTLTTSPGVYRHFDAAGELLYVGKAGNLKKRVGSYFLKPRMEPRI
AAMVAQIARVEITVTRTEGEALLLESQLIKSLKPRYNILLRDDKSYPYIYLSTGEDYPRL
AFHRGAKNLPGRYFGPYPSVYAVRESLNLMQKLFKVRQCEDSYFRNRTRPCLLYQIGRCS
APCVGLISVEDYRNDVRHAEMFLEGRSNAVIDELAEAMEQASKALQFERAAKLRDQVAAL
RQLQAQHHVQGASADMDVLACRIEAGMACVSVLFFRDGISLGTRDFFPRLPLDAEPADVL
AQFITQYYLDRPVPRELILGEPLADQEILAELLGQQAGHAVDLKSSVRGERAQFLQMAER
NAQASLTARLASRQTLGTRFDDLQKVLGLDESPRRIECFDISHTMGELTVASCVVFGPEG
PEKSHYRRFNITGITPGDDYAAMHQALTRRFRKLAEGEGARPDVLLIDGGSGQVAQALGV
LRELGVDGIEVVGVAKGPGRRAGEETLVLARLESGSPGRELHPGSSSPALHLVAAVRDEA
HRFAISGHRKRREKAREHSVLEDVPGIGARRRSALLKAFGGMQGLERAGVEELMQVKGID
RGLAERIYASLHG