Protein Info for LRK53_RS09760 in Rhodanobacter sp000427505 FW510-R12

Annotation: 3-phosphoshikimate 1-carboxyvinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF00275: EPSP_synthase" amino acids 11 to 423 (413 residues), 386.3 bits, see alignment E=8.1e-120 TIGR01356: 3-phosphoshikimate 1-carboxyvinyltransferase" amino acids 17 to 427 (411 residues), 396.5 bits, see alignment E=6.7e-123

Best Hits

Swiss-Prot: 72% identical to AROA_XANC5: 3-phosphoshikimate 1-carboxyvinyltransferase (aroA) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 74% identity to psu:Psesu_1718)

MetaCyc: 46% identical to 5-enolpyruvoylshikimate-3-phosphate synthase (Bacillus subtilis)
3-phosphoshikimate 1-carboxyvinyltransferase. [EC: 2.5.1.19]

Predicted SEED Role

"5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>LRK53_RS09760 3-phosphoshikimate 1-carboxyvinyltransferase (Rhodanobacter sp000427505 FW510-R12)
MSGRLDWSSRPGGPLRGSVRVPGDKSVSHRALMLAAIAEGDSRIRGFLEGEDTRATAAVL
AQLGVRIDTPSPGERVVHGAGLHGLRGTTQALDCGNAGTGMRLLAGLLAGQAFDSTLVGD
ASLSKRPMRRVTDPLALMGARIDTQGGLPPLHVHGGQPLHGIRYELPVASAQVKSALLLA
GLYANGDTEIIEPHPTRDYTERMLAAFGWPIAFAPGRAKLSGGHVLRATDVEVPADFSSA
AFFLVAASIVPGSELRLPAVGLNPRRTGLLEALRLMGANIAIEQEREAGGEPVGDLVVRH
APLHGVELPEALAPDMIDEFPALFIAAAAAGGTTVIRGAAELRVKESDRIATMAAGLRTL
GVAIEETPDGAAIHGGRLGGGTVESHLDHRIAMSFAVAGLVAAGPVRINDCSHVATSFPG
FQELANGCGFALQVAP