Protein Info for LRK53_RS09645 in Rhodanobacter sp000427505 FW510-R12

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 165 to 184 (20 residues), see Phobius details amino acids 191 to 214 (24 residues), see Phobius details amino acids 248 to 270 (23 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 340 to 363 (24 residues), see Phobius details amino acids 379 to 401 (23 residues), see Phobius details amino acids 407 to 426 (20 residues), see Phobius details PF07690: MFS_1" amino acids 36 to 278 (243 residues), 58.7 bits, see alignment E=4.9e-20 amino acids 250 to 427 (178 residues), 51.9 bits, see alignment E=5.6e-18 PF13347: MFS_2" amino acids 73 to 401 (329 residues), 38 bits, see alignment E=7.6e-14

Best Hits

KEGG orthology group: None (inferred from 50% identity to gob:Gobs_1988)

Predicted SEED Role

"putative sugar transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>LRK53_RS09645 MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MIDDEAGVVMRGLPMPVGACAGEAPPVRRAGWPFIAIYGMAYMGLWMALLPPILVGLAMR
VSEITPAHATGSLSLVVGVGALIALFGNPFFGSLSDRTTSRFGMRRPWLIAGAAGGVVGL
AVVAMAVSVPQLLLGWCITQLAYNAQLAALTAILADQIPASQRGMVSGIVGVSLPVGMVG
GTYLVELLAYSALAIFLVPAVIALAGAFLLAWVLPDHHLAAMQRPRYGWREFLGSFWINP
LRFPDFAWAWGSRFLLYAGVALLMTYQEFYLIHQLGCAPAAVPRWIFLSTLVQSGAVAVA
SVVGGGLSDARGRRKAFVCGTALIYALALLMIAFATSYTYFLVAMAITGIAQGGYLAADL
ALVTDVLPERETHAARNLGIFNIANVMPQSLMPAIAPGILLASGGSYTALFTMAAALVAL
GAWAILPVRGAR