Protein Info for LRK53_RS09475 in Rhodanobacter sp000427505 FW510-R12

Annotation: bifunctional 2-methylcitrate dehydratase/aconitate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 TIGR02330: 2-methylcitrate dehydratase" amino acids 15 to 482 (468 residues), 744.5 bits, see alignment E=2.3e-228 PF03972: MmgE_PrpD_N" amino acids 20 to 272 (253 residues), 277.6 bits, see alignment E=7.5e-87 PF19305: MmgE_PrpD_C" amino acids 290 to 462 (173 residues), 202.1 bits, see alignment E=6.1e-64

Best Hits

Swiss-Prot: 61% identical to PRPD_CUPNE: 2-methylcitrate dehydratase (prpD) from Cupriavidus necator

KEGG orthology group: K01720, 2-methylcitrate dehydratase [EC: 4.2.1.79] (inferred from 63% identity to tgr:Tgr7_1507)

MetaCyc: 60% identical to 2-methylcitrate dehydratase (Salmonella enterica enterica serovar Typhimurium)
2-methylcitrate dehydratase. [EC: 4.2.1.79]

Predicted SEED Role

"2-methylcitrate dehydratase (EC 4.2.1.79)" in subsystem Methylcitrate cycle or Propionate-CoA to Succinate Module (EC 4.2.1.79)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (483 amino acids)

>LRK53_RS09475 bifunctional 2-methylcitrate dehydratase/aconitate hydratase (Rhodanobacter sp000427505 FW510-R12)
MSAHDIRSAVRPDPDQPMVDIANYVADYRIDSKEAYDTARYMLLDSLATAMMAMKFPECV
KHLGPLVPGATLPGGARVPGTSHELDPVQAAFAIGTQIRWLDFNDTWLAAEWGHPSDNLG
SILAVGDYLGRKAEREGGQPLTVRDALGYAIKAHEIQGCYALLNSFNRVGQDHVILVRLA
STAVATAMLGGDKEQITTAVSHSWIDNGALRTYRHAPNTGPRKSWAAGDACRRAVTHAIN
AVHRGVVGYPSALSAKTWGFYDVAFKGKPFEFERPFGSYVMENVLFKISYPAEFHAQTAV
ECAMKLHGEVAGRLDQVEKIVIETQEAGCRIIDKTGPLANYADRDHCIQYMVAVPLIFGR
LVASDYNDDVAADPRIDALRDRMTVVENPQFTRDYFDPAKRYIGNSVQVFFKDGSSTEKV
SIDYPIGHRKRRAEGIPVLLQKFEAAMRGHLPAHQVKAIMAAVEDPARLDAMSLHHFLGL
FTL