Protein Info for LRK53_RS09435 in Rhodanobacter sp000427505 FW510-R12

Annotation: malate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01759: malate dehydrogenase
  • amino acids 3 to 319 (317 residues), 496.3 bits, E=1.7e-153
• PF00056: Ldh_1_N
  • amino acids 5 to 148 (144 residues), 115.6 bits, E=1.9e-37
• PF02866: Ldh_1_C
  • amino acids 157 to 319 (163 residues), 149.2 bits, E=1.3e-47

Best Hits

Swiss-Prot: 76% identical to MDH_ALCBS: Malate dehydrogenase (mdh) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: K00024, malate dehydrogenase [EC: 1.1.1.37] (inferred from 76% identity to abo:ABO_1248)

MetaCyc: 66% identical to malate dehydrogenase (Mycobacterium tuberculosis H37Rv)
Malate dehydrogenase. [EC: 1.1.1.37, 1.1.1.38]

Predicted SEED Role

"Malate dehydrogenase (EC 1.1.1.37)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (7/7 steps found)
• TCA cycle III (animals) (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• gluconeogenesis I (11/13 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• mixed acid fermentation (13/16 steps found)
• gluconeogenesis III (10/12 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• malate/L-aspartate shuttle pathway (2/2 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• chitin deacetylation (2/4 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• methylgallate degradation (2/6 steps found)
• methylaspartate cycle (11/19 steps found)
• protocatechuate degradation I (meta-cleavage pathway) (3/8 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• reductive TCA cycle II (5/12 steps found)
• superpathway of vanillin and vanillate degradation (3/10 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• syringate degradation (3/12 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism
• Pyruvate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.37 or 1.1.1.38

Protein Sequence (328 amino acids)

>LRK53_RS09435 malate dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MKAPVRVAVTGAAGQIGYALLFRIAAGDMLGSDQPVILHLLEITPALPALQGVVMELNDC
AFPTLAGVVATDDANVAFKDVDYALLVGARPRGPGMERKDLLEANGAIFGPQGKALNAHA
KRDVRVLVVGNPANTNALIAQQNAPDLDPKCFTAMVRLDHNRAKSQLAEKTSKHNTDVRK
MTIWGNHSSTQYPDLHHATVNGKPALSLVDQAWYESDFIPTVQQRGAAIIKARGASSAAS
AASAAIDHMRTWALGTEEGDWVSMGIPSDGSYGIAPGVIYGYPVTVKNGKYAIVQGLEIS
AFSRARMDATDKELREERAGVEHLFAKK