Protein Info for LRK53_RS09305 in Rhodanobacter sp000427505 FW510-R12
Annotation: amidohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to YAFV_ECOLI: Omega-amidase YafV (yafV) from Escherichia coli (strain K12)
KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 63% identity to psu:Psesu_1275)MetaCyc: 47% identical to 2-oxoglutaramate amidase (Escherichia coli K-12 substr. MG1655)
Omega-amidase. [EC: 3.5.1.111, 3.5.1.3]
Predicted SEED Role
No annotation
MetaCyc Pathways
- L-methionine salvage cycle III (10/11 steps found)
- S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)
- L-methionine salvage cycle I (bacteria and plants) (9/12 steps found)
- L-methionine salvage cycle II (plants) (7/11 steps found)
- nicotine degradation I (pyridine pathway) (5/17 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.1.111 or 3.5.1.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (273 amino acids)
>LRK53_RS09305 amidohydrolase (Rhodanobacter sp000427505 FW510-R12) MSSDGVSLEPLRVSLVQGATRWHDAPANRDYYGTLVHQVRGSDLVVLPETFLSGFSNDTH ASADTMDGEGVAWLRALAAEVDAVVCGSLAIREDGVVYNRLLWMRPDGSFAQYDKRHLFR MAGEHTRYGGGSERLVVELKGWRILPQVCYDLRFPVWLRNRRLASAGGGMDYDLAIFVAN WPAPRRQPWRTLLRARAIENLCYVAGVNRVGVDGNELPYAGDSAVIDPVGEPLVELGAQE QVVTVTLDLAPLLAHRKRFPAWMDADAFSLDPG