Protein Info for LRK53_RS09255 in Rhodanobacter sp000427505 FW510-R12

Annotation: ABC-2 transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 130 to 163 (34 residues), see Phobius details amino acids 180 to 207 (28 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 296 to 320 (25 residues), see Phobius details

Best Hits

Predicted SEED Role

"ABC transporter, permease protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>LRK53_RS09255 ABC-2 transporter permease (Rhodanobacter sp000427505 FW510-R12)
MKTFYWLIKREFWEHRGSFVWAPIITGGVVLLLTLMSIITGEVFRVRGGVHVNGIDFNTI
TAHMGADALDTIGKALDISILTPAVLIGIVLFVVVFFYSLNSLYDDRRDRSILFWKSLPI
SDRDTVLSKVACATVLAPAIAIVTSVATGLLVLVMLAITASFHGAHLWQMLWTLPHPFRI
ATVMLSNIPLYVVWALPTVGWLMLCSAWARGKPFLWALIIPVGTGIVVSWFNLMGLFNLS
DKWFWGNVVGRALLSVFPGGWIPGQLSDDVASKFGQTASDNHQIFANMLDLTHNYAVLVT
PQFLIGAVAGVAMLAGAIWFRRWRDDS