Protein Info for LRK53_RS09135 in Rhodanobacter sp000427505 FW510-R12

Annotation: twitching motility response regulator PilH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF00072: Response_reg" amino acids 4 to 116 (113 residues), 101.2 bits, see alignment E=2e-33

Best Hits

Swiss-Prot: 61% identical to PILH_PSEAE: Protein PilH (pilH) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02658, twitching motility two-component system response regulator PilH (inferred from 75% identity to smt:Smal_3018)

Predicted SEED Role

"twitching motility protein PilH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>LRK53_RS09135 twitching motility response regulator PilH (Rhodanobacter sp000427505 FW510-R12)
MARILIVDDSPSQLLGIKRIVEKLGHETLSAEDGAAGVEVAKAEKPDLILMDVVMPNLNG
FQATRTISKNAETAHIPIILVTTKDQETDRVWGMRQGAKAYVTKPIKEEELLKALQEFLP
G