Protein Info for LRK53_RS09070 in Rhodanobacter sp000427505 FW510-R12

Annotation: translation initiation factor IF-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 931 PF04760: IF2_N" amino acids 1 to 46 (46 residues), 25.9 bits, see alignment 2.9e-09 amino acids 357 to 403 (47 residues), 46.3 bits, see alignment 1.2e-15 PF08364: IF2_assoc" amino acids 68 to 111 (44 residues), 50.1 bits, see alignment 1.1e-16 TIGR00487: translation initiation factor IF-2" amino acids 347 to 931 (585 residues), 821.9 bits, see alignment E=3.6e-251 TIGR00231: small GTP-binding protein domain" amino acids 433 to 590 (158 residues), 103.8 bits, see alignment E=8e-34 PF00009: GTP_EFTU" amino acids 436 to 591 (156 residues), 124.7 bits, see alignment E=1.3e-39 PF01926: MMR_HSR1" amino acids 436 to 541 (106 residues), 40.1 bits, see alignment E=1.4e-13 PF00071: Ras" amino acids 437 to 590 (154 residues), 21.8 bits, see alignment E=4.9e-08 PF22042: EF-G_D2" amino acids 607 to 685 (79 residues), 102.8 bits, see alignment E=3.5e-33 PF11987: IF-2" amino acids 710 to 821 (112 residues), 127.7 bits, see alignment E=8.6e-41 PF03144: GTP_EFTU_D2" amino acids 852 to 919 (68 residues), 33.6 bits, see alignment 1.7e-11

Best Hits

Predicted SEED Role

"Translation initiation factor 2" in subsystem NusA-TFII Cluster or Translation initiation factors eukaryotic and archaeal or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (931 amino acids)

>LRK53_RS09070 translation initiation factor IF-2 (Rhodanobacter sp000427505 FW510-R12)
MSDVTIKQLAQVLGMPVDRLLTQLGEAGMKFSDQEQVISSTEKVKLLGFLRRTHGKGEAA
SEADDSAPRQITLKRRTVGELKVATPGGRGAAGTAKTVNVEVRAKRTYVKRSVIAEEASA
EPEREEAVRKLQESQQQREQEERERVEAEQRRQAEAQHALDEQRRKAEKEQREAELARAA
EPVAVEHVEATPEPAAEVAPAAAHDDATGTVQRIDQRDLGMILPRIHEPRKREKLVKPVA
APAAPAAPAARGAVAGAAAPAAAGEAARGKPKHPRERSENLGKEDREAGKRFAGGQMHLS
EADRARRSSSSKRAKPGRSGGREALRGGGAAAAGPHGFSRPTAPVVREVVVSDTNVVADL
AQKMAVKGSEVVKALFKMGVMATINQTVDHDTAVLVVEELGHTPVADTQNNAEETLAAHT
QNIELEGEKVTRPPVVTIMGHVDHGKTSLLDYIRRTKVASGEAGGITQHIGAYHVETSRG
VITFLDTPGHAAFTSMRARGAQSTDIVILVVAADDGVKPQTIEAVKHARAAKVPLIVAVN
KMDKDGANPDNVKQGLVAQEVVPEDWGGDVQFVPVSAKTGMGIENLLDAISVQAEVMELR
AVVDGRASGVVIESSLDRGRGPVATVLVQQGTLRKGDFVVCGVEYGRMRALIDETGKQVA
EAGPSIPVQVLGLSGVPETGDDFVAVEDERLAREVAEERQLKRRETRMVSKSNRLEDIIA
KMGQGEEQQTLNILVKGDVQGSVEALRESLTQIGNDRVRVNVVASGVGGITESDATLATA
SKALLIGFNVRADASARKVIETNAVDVRYFSIIYDVIDQVTQAATGLLGMEVREDIIGTA
EVRDVFRSSKFGAVAGCMVTEGSVKRNKPIRVLRDHVVIFEGELESLRRFKDLVDEVRAG
MECGIAVKQYNDVKPGDQIECFERTEVARTL