Protein Info for LRK53_RS09050 in Rhodanobacter sp000427505 FW510-R12

Annotation: CDP-alcohol phosphatidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 transmembrane" amino acids 23 to 47 (25 residues), see Phobius details amino acids 53 to 70 (18 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 166 to 182 (17 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 28 to 175 (148 residues), 44.8 bits, see alignment E=9.1e-16

Best Hits

KEGG orthology group: None (inferred from 47% identity to cst:CLOST_0781)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (196 amino acids)

>LRK53_RS09050 CDP-alcohol phosphatidyltransferase family protein (Rhodanobacter sp000427505 FW510-R12)
MLDTRARHLVEPFIARVARGLKALGLSANAVTALAMLVGVVAALSIALDQPWLGIGLLWL
SGLLDASDGALARMTHTSPLGAIMDITFDRVVEVAMIVALAWRHPEARFMLVILAGEIAV
AMSLFLSIAAAIRNTSVKSFHYSPGLGERTEAFICLTLMVADRSHLLIWTGVFIAVIGYT
MVQRLRHAARWLSLPS