Protein Info for LRK53_RS09040 in Rhodanobacter sp000427505 FW510-R12

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 61 to 81 (21 residues), see Phobius details amino acids 101 to 122 (22 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 172 to 197 (26 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 253 (163 residues), 31.7 bits, see alignment E=6.4e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>LRK53_RS09040 ABC transporter permease subunit (Rhodanobacter sp000427505 FW510-R12)
MSVRRVLASLLALALVAPPLLLGMLSVARQWRWPALWPTAWQVQQWHEVAGDLTGAGMMG
ALARSLALALTVAVVATALGLPTSRRVAGLPRRGAWLTALHLPYALSPVVLAVGLLFAFL
HLHLAGHLLGVLLAQLVFAYAYAVILLSALWTPRVAALEDLASTLGARRLQVWWRVLVPV
ARPMLAVCLFQTFLISWFDYALVRLIGQGEVQTLTIRLFEYFTSGDLRLAATCALILMTP
PLVTLLVHRAVPPSLLAPQAGSSHE