Protein Info for LRK53_RS08995 in Rhodanobacter sp000427505 FW510-R12

Annotation: NADH-quinone oxidoreductase subunit M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 72 to 102 (31 residues), see Phobius details amino acids 111 to 127 (17 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 205 to 229 (25 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details amino acids 299 to 322 (24 residues), see Phobius details amino acids 342 to 360 (19 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details amino acids 461 to 478 (18 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 6 to 495 (490 residues), 588.5 bits, see alignment E=4.9e-181 PF00361: Proton_antipo_M" amino acids 129 to 427 (299 residues), 248.2 bits, see alignment E=5.3e-78

Best Hits

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 63% identity to xft:PD0260)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>LRK53_RS08995 NADH-quinone oxidoreductase subunit M (Rhodanobacter sp000427505 FW510-R12)
MFTHLLSLLIWLPIVGAVPVLLAGSARPMLARWLALLITIATFVISLWLLRYDPNGSVMQ
MQETHVWIATWGVHFTLAVDGISVALILMTTFVGILVIGGAWKVIQNRPHQYMACMLLLE
GLLIGVFCATDALVFYAFFEAVLIPMYILIGMWGGPRRVYATLKLFIYTFTGSVFMLIAL
LYLYQKAHTFDLATLAALPLTMKEQAWLFFGFLIAFAIKVPMVPVHTWLPDAHVEAPTGG
SVWLAAVMLKIGTYGMVRFILPITPDAGAHFAWIVIVLSLVAIIYIGYVALVQEDMKKLV
AYSSVAHMGFVTLGIFMAFMLVREGGNTEMASLGMQGAMVQMISHGFVSGAMFTCIGVMY
DRTHTRQIKDYGGVINMMPWFGFFYVLFAMANCGLPGTSGFVGEFMVILASFSASPWIAL
FATFTLIIGAGYTLWLVKRVLWGPVTTEHVRHMTPMTARETWVLIGFAVAVLIIGVWPQP
LVHLMDSSVAHLVQQLAVHKI