Protein Info for LRK53_RS08950 in Rhodanobacter sp000427505 FW510-R12

Annotation: NADH-quinone oxidoreductase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 110 to 131 (22 residues), see Phobius details TIGR01962: NADH dehydrogenase (quinone), D subunit" amino acids 6 to 417 (412 residues), 597.9 bits, see alignment E=3.7e-184 PF00346: Complex1_49kDa" amino acids 120 to 169 (50 residues), 59.1 bits, see alignment 2e-20 amino acids 192 to 417 (226 residues), 322.3 bits, see alignment E=1.1e-100

Best Hits

Swiss-Prot: 86% identical to NUOD_STRMK: NADH-quinone oxidoreductase subunit D (nuoD) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K00333, NADH dehydrogenase I subunit D [EC: 1.6.5.3] (inferred from 88% identity to psu:Psesu_1842)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain D (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (417 amino acids)

>LRK53_RS08950 NADH-quinone oxidoreductase subunit D (Rhodanobacter sp000427505 FW510-R12)
MQEIRNYTMNFGPQHPAAHGVLRLIMEMDGETIVRIDPHVGLLHRGTEKLAESKPFNQSI
GYMDRLDYVSMMCNEHAYVRAIETLLGIEAPERAQYIRTMFDEITRILNHLMWIGSNALD
LGAMAVMLYAFREREELMDVYEAVSGARMHATYYRPGGVYRDLPAQMSQYRESPWHKGAD
LKRINSWREGSMLDFLDAFTADFPSKVDEYEVLLTTNRIWKQRTVGIGVVSPELAQQWGM
TGAMLRGSGVEWDLRKKQPYAKYAEMDFDIPVGVNGDCYDRYLVRVEEMRQSNRIIRQCV
EWLRANPGPVMVKNFKVAPPSRVEMKQDMEALIHHFKLFTEGYCVPAGETYCAVEAPKGE
FGCYLVSDGANKPFRVHLRAPGFAHLSSMDTVVHGHMLADVVAMIGTYDLVFGEVDR