Protein Info for LRK53_RS08765 in Rhodanobacter sp000427505 FW510-R12

Annotation: histidine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR00442: histidine--tRNA ligase" amino acids 9 to 438 (430 residues), 407.9 bits, see alignment E=2.4e-126 PF13393: tRNA-synt_His" amino acids 12 to 341 (330 residues), 119.2 bits, see alignment E=3.5e-38 PF00587: tRNA-synt_2b" amino acids 76 to 176 (101 residues), 31.5 bits, see alignment E=2.7e-11 PF03129: HGTP_anticodon" amino acids 360 to 447 (88 residues), 65 bits, see alignment E=8.5e-22

Best Hits

Swiss-Prot: 72% identical to SYH_XANC8: Histidine--tRNA ligase (hisS) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 72% identity to xcb:XC_2383)

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>LRK53_RS08765 histidine--tRNA ligase (Rhodanobacter sp000427505 FW510-R12)
MALTPARTMPGVLELLPLDQIAFQRMLDVIRRNYERFGFLAVETPVIEYADVLLTKTGGE
TERQVYFVQSTGALEQGEKPDLALRFDLTVPLARYVAEHERDLNFPFRRYQMQKVYRGER
AQRGRFREFYQCDIDVIGKDALSVRYDAEIPAVIYSVFRELDIGSFTIQLNNRKLMRGYF
ESLGIVDGEQQMLVLREVDKLDKRGADYVRDTLTGEAFGLSTEVAQKILAFVQVRSTSLQ
DALDKLDALGPGPEALEQGRNELKEVLGLIHAFGVPQTHYVLNLSIARGLDYYTGTVYET
TLNDHPQIGSICSGGRYENLAGQYTKSHLPGVGISIGLTRLYWQLRDAGLIDTAKSTVDV
LVTQMDESQLPAYLALAGELRGAGIATEVVLEGSKLGKQFKYADRAGIRFVVVLGEDELA
RGVVTVKDLRREDQFEVARGELVKTLRVELEQAAAMG