Protein Info for LRK53_RS08600 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphatase PAP2 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 53 to 75 (23 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details PF01569: PAP2" amino acids 141 to 251 (111 residues), 55.5 bits, see alignment E=2.5e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>LRK53_RS08600 phosphatase PAP2 family protein (Rhodanobacter sp000427505 FW510-R12)
MDPMVEWIAAHALRLWALLLLLALLTGDLVWRYNARRQRHALVRGDEPTVLRWQVGLVLL
LALTLLFLAIASAVAGQPAGELVRFDSSLAEDLHAQLPLPVLRGIAAVTHLGDLWWVASA
AAVVALFLLLRRHGRLAGIWALALLGIQPINGSLKALFRRVRPLHDHGFVVEPGWSFPSG
HAFGAIVFYGMLAYVLLRLLPPRFHRAVVAAAVLLVGVVGISRIMLQVHYFSDVMGGYAA
GGAWLVLCIGAAEQLRRPATGVRP