Protein Info for LRK53_RS08555 in Rhodanobacter sp000427505 FW510-R12

Annotation: peptide-methionine (S)-S-oxide reductase MsrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR00401: peptide-methionine (S)-S-oxide reductase" amino acids 50 to 199 (150 residues), 169.1 bits, see alignment E=4.5e-54 PF01625: PMSR" amino acids 50 to 214 (165 residues), 216.8 bits, see alignment E=1e-68

Best Hits

Swiss-Prot: 56% identical to MSRA2_RHILO: Peptide methionine sulfoxide reductase MsrA 2 (msrA2) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K07304, peptide-methionine (S)-S-oxide reductase [EC: 1.8.4.11] (inferred from 60% identity to sus:Acid_6211)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11

Use Curated BLAST to search for 1.8.4.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>LRK53_RS08555 peptide-methionine (S)-S-oxide reductase MsrA (Rhodanobacter sp000427505 FW510-R12)
MIRRSTFQSVSLAALLMLGANACQPVSAASGALPAPTVDTPETAAHGEQVAVLAGGCFWG
VEAVFEHVRGVNEVIAGYSGGDADTAHYDEVSAGDTGHAESVQVHFDPAQVSYGTLLQVF
FSVALDPTERNRQGPDVGSQYRSVIFYANPEQQRIAGAYIAQLTAAKTFPAPIVTQVVPL
RAFYPAEAYHQHYFQRHPYNPYIAINDAPKVAQLRQLLPELYQVSL