Protein Info for LRK53_RS08490 in Rhodanobacter sp000427505 FW510-R12

Annotation: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF01502: PRA-CH" amino acids 34 to 106 (73 residues), 112 bits, see alignment E=8.8e-37 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 117 to 200 (84 residues), 94 bits, see alignment E=2.6e-31 PF01503: PRA-PH" amino acids 118 to 204 (87 residues), 69.4 bits, see alignment E=2.9e-23

Best Hits

Swiss-Prot: 73% identical to HIS2_XANCP: Histidine biosynthesis bifunctional protein HisIE (hisI) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K11755, phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC: 3.5.4.19 3.6.1.31] (inferred from 73% identity to xca:xccb100_2102)

MetaCyc: 60% identical to putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
Phosphoribosyl-ATP diphosphatase. [EC: 3.6.1.31]; Phosphoribosyl-AMP cyclohydrolase. [EC: 3.6.1.31, 3.5.4.19]

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.5.4.19, EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19 or 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (208 amino acids)

>LRK53_RS08490 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase HisIE (Rhodanobacter sp000427505 FW510-R12)
MTDPNADFSRLDWAKGDGLLPAVVQHWLSGEVLMLGYMNAEALAQTQASGQVTFYSRSKQ
RLWTKGESSGHVLALKSIRTDCDADTLLIQAAPHGPTCHLGTSSCFGEDPRPPLGFLAEL
DALVARRHAERPEGSYTTKLFDGGIRRIAQKVGEEGVETALAAVAQGDAELLGEAADLLF
HLTVALRARGLGLADVARVLAERHARRG