Protein Info for LRK53_RS08370 in Rhodanobacter sp000427505 FW510-R12

Annotation: glycosyltransferase family 1 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 PF13439: Glyco_transf_4" amino acids 14 to 180 (167 residues), 102.1 bits, see alignment E=8.7e-33 PF13579: Glyco_trans_4_4" amino acids 15 to 172 (158 residues), 77.9 bits, see alignment E=2.8e-25 PF00534: Glycos_transf_1" amino acids 192 to 348 (157 residues), 94 bits, see alignment E=1.9e-30 PF13692: Glyco_trans_1_4" amino acids 202 to 337 (136 residues), 111.5 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: None (inferred from 58% identity to psu:Psesu_1981)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>LRK53_RS08370 glycosyltransferase family 1 protein (Rhodanobacter sp000427505 FW510-R12)
MRIGIVSETYPPEINGVALTVHSLAAGLAARGHCIDLIRPRQPQSHGDESGIDVLELRGG
ALPRYPGLRFGLPAGRTLRRHWSRQRPDAVYVATEGPLGWSAVRAARQLGIPLSSGFHTR
FDSYASHYGVGLLTPLVRGYLRRFHQRAAATLVPTDALAQELHAMGITNTRLLRRAVDTQ
LFHPNRRDMALRADWGVDAATPVVLYVGRIAPEKNLELAARTFRAIQQQVPRARYVWVGD
GPARDALQAAHPDFIFAGVQRGEALARHYASADLFPFPSLSETFGNVIIEALAAGLPVVA
YAEGAAREHLVDGVNGCCIATGDEAAFIDATVRLASNPALIRHMGRAAHAGVAGLSPEAV
IRDFENLLREMAEENLHEHASVAAQL