Protein Info for LRK53_RS08260 in Rhodanobacter sp000427505 FW510-R12

Annotation: 30S ribosomal protein S12 methylthiotransferase RimO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 TIGR01125: ribosomal protein S12 methylthiotransferase RimO" amino acids 7 to 434 (428 residues), 564.4 bits, see alignment E=1.9e-173 PF00919: UPF0004" amino acids 7 to 86 (80 residues), 67.5 bits, see alignment E=1.3e-22 TIGR00089: radical SAM methylthiotransferase, MiaB/RimO family" amino acids 7 to 435 (429 residues), 340.2 bits, see alignment E=1.7e-105 PF04055: Radical_SAM" amino acids 142 to 320 (179 residues), 97.2 bits, see alignment E=1.9e-31 PF18693: TRAM_2" amino acids 376 to 436 (61 residues), 71.1 bits, see alignment E=1e-23

Best Hits

Swiss-Prot: 75% identical to RIMO_XANC8: Ribosomal protein S12 methylthiotransferase RimO (rimO) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K14441, ribosomal protein S12 methylthiotransferase [EC: 2.-.-.-] (inferred from 75% identity to xcb:XC_1554)

MetaCyc: 66% identical to ribosomal protein S12 methylthiotransferase RimO (Escherichia coli K-12 substr. MG1655)
RXN0-6366 [EC: 2.8.4.4]

Predicted SEED Role

"Ribosomal protein S12p Asp88 (E. coli) methylthiotransferase" in subsystem Ribosomal protein S12p Asp methylthiotransferase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.8.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>LRK53_RS08260 30S ribosomal protein S12 methylthiotransferase RimO (Rhodanobacter sp000427505 FW510-R12)
MSQTAHKIGFVSLGCPKALVDSERILTQLKVEGYQIVPSYGEADAVVVNTCGFIDAAVQE
SLDSIGTALNENGKVIVTGCLGKREALIREAYPDVLSISGPQDYASVMSAVHQALPPQRN
KFIDIVPDTGVKLTPKHYAYLKISEGCNHRCSFCIIPSMRGNLVSRPVDEVLVEAEKLVK
GGVKELLVISQDTSAYGVDLKYAERPWRGKAYRTRMTELCEGLAELGAWTRLHYVYPYPH
VDELMPLMAEGKLLPYLDIPFQHASPRILKLMKRPGNIDKTLERIRNWRAQVPDLTIRST
FIVGFPGETDAEFEELLDFLREAELDRVGAFAYSPVDGAKANELPGAVSEELKEDRLEQF
MAVQAEISAAKLQRKIGRTLKVLVDEANADGAVARSAADAPEIDGSVLIADGQHLKPGQF
VDVVVEAASDHDLTARLARPTLKVI