Protein Info for LRK53_RS08190 in Rhodanobacter sp000427505 FW510-R12

Annotation: sensor domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 106 to 127 (22 residues), see Phobius details amino acids 133 to 157 (25 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF22564: HAAS" amino acids 9 to 68 (60 residues), 31.5 bits, see alignment E=1.8e-11 PF13796: Sensor" amino acids 111 to 299 (189 residues), 120.5 bits, see alignment E=7.6e-39

Best Hits

KEGG orthology group: None (inferred from 65% identity to xca:xccb100_2944)

Predicted SEED Role

"sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>LRK53_RS08190 sensor domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MNAPRTIVEYLEQLRVALRGADPALVQDALYDAEEHLRAELAEQPGRSEAAMLEHVVGSY
GAPDEVAEIYRDQEIKIQRALRPPPSPKRRSLAGRFFGVAADPRTYGALFYMLLALATGI
FYFTWAVTGLSLSLGLSVLIIGLPFIVLFFGSVRVLSLVEGRIVEAMLGMRMPRRPVYPT
QGMSLMQRIGSMFTDVHTWTTLCYMWLMLPLGIVYFTLAVTLLSVSVAFIGAPLAMLFRD
DSWLSWPRQVTVDWGFGAHVPGWGDAIAMCVIGIVLLFATLHLARTLGRVHGQVAKHMLV
PRAAD