Protein Info for LRK53_RS08055 in Rhodanobacter sp000427505 FW510-R12

Annotation: copper resistance system multicopper oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 signal peptide" amino acids 1 to 41 (41 residues), see Phobius details TIGR01480: copper-resistance protein, CopA family" amino acids 10 to 584 (575 residues), 972.3 bits, see alignment E=8.8e-297 TIGR01409: Tat (twin-arginine translocation) pathway signal sequence" amino acids 12 to 40 (29 residues), 24.3 bits, see alignment (E = 2.9e-09) PF07732: Cu-oxidase_3" amino acids 60 to 170 (111 residues), 127.8 bits, see alignment E=3.5e-41 PF00394: Cu-oxidase" amino acids 180 to 342 (163 residues), 79.7 bits, see alignment E=3.9e-26 PF07731: Cu-oxidase_2" amino acids 468 to 584 (117 residues), 104.4 bits, see alignment E=6.5e-34

Best Hits

Swiss-Prot: 64% identical to COPA_PSESM: Copper resistance protein A homolog (copA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 63% identity to rme:Rmet_6112)

Predicted SEED Role

"Multicopper oxidase" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (585 amino acids)

>LRK53_RS08055 copper resistance system multicopper oxidase (Rhodanobacter sp000427505 FW510-R12)
MNPFSPLPATDLSRRRFVQGLALGSAVAGFGLLRPPNAWALTSPGQPTVLSGTDFALDVV
ETAVNFTGAARPAITVNGSVPGPLLRWRQGTTVNLRVTNRLRVPTSIHWHGIILPFQMDG
VPGISFGGIAPGESFLYRFQVRQSGTYWYHSHSGFQEQNALYGPLVIEPDGPERYPTDRD
YVVMLNDWTDEDPERIYAKLKKQSDYYNFAQPTVPDFLRDVRAKGLSQALAMRKMWNQMR
MNPTDLSDVSGYTYTYLMNGAAPAGNWTGIFKPGEKIRLRFINGSSSTIFDVRIPGLKMT
VIAADGQDVQPVPVDEFRFSPAEIYDVIVEPQEERAYTLFAQSIDRSGYARGTLAPRAGM
EAEVPSVDKRVWLDMRDMMGAMSHADHGGQAAMPGMDHGGMDHGSMSGMAAAPVVRHARA
EYGPGVDMHVDMPRSNLDDPGTGLRDNGRRVLTYADLHTIGGPIDAREPSREIELHLTGN
MERFMWSFDGIKYSDARPVHFNTGERLRIVLVNDTMMNHPIHLHGMWSELENPGGQFQVR
KHTVNVQPAQRVSYAVTADAPGRWAYHCHLLYHMEAGMFREVVVA