Protein Info for LRK53_RS07800 in Rhodanobacter sp000427505 FW510-R12

Annotation: type IV pilus modification protein PilV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details PF07963: N_methyl" amino acids 16 to 40 (25 residues), 26 bits, see alignment 2.5e-10 TIGR02523: type IV pilus modification protein PilV" amino acids 18 to 138 (121 residues), 64.6 bits, see alignment E=1.4e-21 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 18 to 40 (23 residues), 19.6 bits, see alignment 6.2e-08

Best Hits

KEGG orthology group: K02671, type IV pilus assembly protein PilV (inferred from 70% identity to hna:Hneap_0016)

Predicted SEED Role

"Type IV fimbrial biogenesis protein PilV" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>LRK53_RS07800 type IV pilus modification protein PilV (Rhodanobacter sp000427505 FW510-R12)
MIRRPVPAMPCVAARPAQSGVSLIEVLIAVLVLSIAFLGIAALQAVSLSTNNSAMARSMA
TVASYSILDAMRADIVSAKNGNYNKTVTANACSSTVTTLADTQLAQWCNQLGRNLGAAAA
TKGTVDCTGAGVCTVTIAFDDSRAGKGGSSNQTVTTKAML