Protein Info for LRK53_RS07795 in Rhodanobacter sp000427505 FW510-R12

Annotation: GspH/FimT family pseudopilin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 38 to 60 (23 residues), see Phobius details PF07963: N_methyl" amino acids 32 to 57 (26 residues), 32.1 bits, see alignment (E = 5.9e-12) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 36 to 58 (23 residues), 24.8 bits, see alignment (E = 6.9e-10) PF12019: GspH" amino acids 73 to 190 (118 residues), 37.2 bits, see alignment E=3.5e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>LRK53_RS07795 GspH/FimT family pseudopilin (Rhodanobacter sp000427505 FW510-R12)
MQVWSRQRDVSLIRARTSADAGDRPWWRTPVRRRERGFTLVELLITMAVAVVLIVIAVPS
FKNITLSNKLTTAANDIVNAIHVARMEAVKRNANTQLCSNSASANGADALGVACSTQSGA
VYAVANGAASQVLAGTVGITGAVQLKGDMTAIRFGGQGLGQKAGTTVPYTGTVADICTGQ
MSKDNHRTISMTTGSILVVDTSSGACP