Protein Info for LRK53_RS07620 in Rhodanobacter sp000427505 FW510-R12

Annotation: kynureninase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 TIGR01814: kynureninase" amino acids 13 to 422 (410 residues), 464.4 bits, see alignment E=1.5e-143 PF00266: Aminotran_5" amino acids 160 to 386 (227 residues), 39.5 bits, see alignment E=3.5e-14 PF22580: KYNU_C" amino acids 327 to 418 (92 residues), 87.8 bits, see alignment E=3.9e-29

Best Hits

Swiss-Prot: 70% identical to KYNU_STRMK: Kynureninase (kynU) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K01556, kynureninase [EC: 3.7.1.3] (inferred from 70% identity to sml:Smlt3160)

Predicted SEED Role

"Kynureninase (EC 3.7.1.3)" in subsystem NAD and NADP cofactor biosynthesis global (EC 3.7.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>LRK53_RS07620 kynureninase (Rhodanobacter sp000427505 FW510-R12)
MPASFEATLDWANARDAADPLRAFRDEFLIPPHEGRDSAYFCGNSLGLQPRAVREAVNAE
LDYWGELGVEGHFKGRLPWMDYHEFVRDDLATIVGAQPTEVVTMNTLGVNLHLMMVSFYR
PRAERPAILIEAGAFPTDRYAVESQIRFHGFDPASALIELQSDEPNGTTSLAAIERALAE
HGSRIALVLLPGVQYRTGQAFDLEAITALGHKHGCTVGFDLAHAVGNLPLQLHDSGADFA
IWCSYKYLNSGPGAVGGAFVHERHAQAVLPRFAGWWGHDKATRFQMGPEFRPTPGADGWQ
LSNPPILALAPLRVSLEIFRRAGMNALREKSLQLTGYLEWLVQTQLADVLQVLTPAEPQR
RGAQLSIRVTGGRERGRALFEYLMDHGIIGDWREPDVIRISPAPLYNRFADCLAFAEAVR
AWGRGD