Protein Info for LRK53_RS07570 in Rhodanobacter sp000427505 FW510-R12

Annotation: glutamate 5-kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 PF00696: AA_kinase" amino acids 23 to 249 (227 residues), 135.5 bits, see alignment E=2.6e-43 TIGR01027: glutamate 5-kinase" amino acids 23 to 381 (359 residues), 398.8 bits, see alignment E=1.2e-123 PF01472: PUA" amino acids 292 to 363 (72 residues), 68 bits, see alignment E=5.7e-23

Best Hits

Swiss-Prot: 67% identical to PROB_XYLFM: Glutamate 5-kinase (proB) from Xylella fastidiosa (strain M12)

KEGG orthology group: K00931, glutamate 5-kinase [EC: 2.7.2.11] (inferred from 71% identity to xca:xccb100_1940)

Predicted SEED Role

"Glutamate 5-kinase (EC 2.7.2.11) / RNA-binding C-terminal domain PUA" in subsystem Proline Synthesis (EC 2.7.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (395 amino acids)

>LRK53_RS07570 glutamate 5-kinase (Rhodanobacter sp000427505 FW510-R12)
MAAIDTGNTHTELPAQALPSWRRAVLKVGSNLLAADGGGLTPRYAETLAAFIAASHAEGR
QVVLVSSGAVAAGRSLLRQHARDGGGLAARQALAALGQAPMIALWQSLSARPVAQVLLTH
DDLRNRRRYLNARATLRELLQLGVLPVVNENDTVSVDELKLGDNDNLAAIVAALVDADLL
LIASDVDALYSADPRHDPAATPITHVAALTPEIVAMAGGSGSAAGTGGMRTKLQAAAKAA
AAGIPTALFSGREAVTVQALQRGQLRGTLIAAASTRLQARKYWLRHAPAAPGRIRIDAGA
AKALAGGRVSLLPGGVLGADGEFHRGDLVEIVDMDGAAVARGLSQYGAAEVRRLAGRHSR
EIGGVLGYSYGDEVVHRDDLVTMNRPVTSGQEISA