Protein Info for LRK53_RS07485 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphoglycolate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 PF00702: Hydrolase" amino acids 8 to 184 (177 residues), 97.6 bits, see alignment E=2.5e-31 PF12710: HAD" amino acids 11 to 179 (169 residues), 38 bits, see alignment E=5e-13 TIGR01449: phosphoglycolate phosphatase, bacterial" amino acids 11 to 219 (209 residues), 185.3 bits, see alignment E=2.2e-58 PF13419: HAD_2" amino acids 11 to 190 (180 residues), 115.1 bits, see alignment E=8.5e-37 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 82 to 190 (109 residues), 33.9 bits, see alignment E=6.6e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 90 to 184 (95 residues), 28.6 bits, see alignment E=3.5e-10 PF13242: Hydrolase_like" amino acids 146 to 199 (54 residues), 34.4 bits, see alignment E=3.3e-12

Best Hits

Swiss-Prot: 46% identical to GPH_XANCP: Phosphoglycolate phosphatase (gph) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K01091, phosphoglycolate phosphatase [EC: 3.1.3.18] (inferred from 51% identity to xop:PXO_00378)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.18

Use Curated BLAST to search for 3.1.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (226 amino acids)

>LRK53_RS07485 phosphoglycolate phosphatase (Rhodanobacter sp000427505 FW510-R12)
MKPLPENIQGVLFDLDGTLLDSAPDLYAALLAQCAEENVAPPPYAAVREVVSRGARAVLR
TAFAACGEPALEALVPRYLQLYQDVMAQQTRAFDGIDELLARIEAHGLRWGIVTNKAGFL
TDELVARIGWAGRAGAVVSGDTLAVKKPDPAPVLLACERAGVAPAQSLFVGDDRRDVQAG
AAAGLYTVAVSWGYLDGGDPHDWGADAVLDHPAGLVELLKLQPVVA