Protein Info for LRK53_RS07205 in Rhodanobacter sp000427505 FW510-R12

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details PF07715: Plug" amino acids 79 to 178 (100 residues), 61.7 bits, see alignment E=8.9e-21 TIGR01783: TonB-dependent siderophore receptor" amino acids 80 to 719 (640 residues), 417.5 bits, see alignment E=5.7e-129 PF00593: TonB_dep_Rec_b-barrel" amino acids 252 to 689 (438 residues), 237.9 bits, see alignment E=4.3e-74

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 43% identity to mrd:Mrad2831_6086)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (720 amino acids)

>LRK53_RS07205 TonB-dependent siderophore receptor (Rhodanobacter sp000427505 FW510-R12)
MPLPIASSVAAPLPRAIRQALTSLPLLAALALLAAPTYAADTAAADDAQRKATTLEGVQV
TAPIAKDSDSVTKTDTPIVEIPQSVSVITDEQMRVRGIHGIEEAVWYTAGAQGGGYGPDS
RSDWLLVRGFAPARYMDGLALPAGSGTELTRIEPYGLERLEVLKGPSSVVYGAMPPGGMI
NMVSKRPTEQPLHEVGVELGSFDLRQGTFDFGGPLNDSGTLLYRLTGLARNSDTMVDYIK
DDRYYLAPALTWKPDNSTSLTVLSRFQKADTASGGGFLPASGTLLSNPNGKIPRHRFTGE
PGQNDYNKKIASIGYEFHHDFASGLAFNQNLRYGKADVDNNGANVGAFGLLADQRTLLRY
LFPNENHTKTFGVDNNLQYTFGSGNVQHVVLAGIDYRRSKDDYASAFAFNAPPLDIFDPV
YGSPVTVPAYTSHTVQTQSQLGVYLQDQVKLGRWGITIGGRQDRVKTDTDNRLGGSTAHQ
TDHAFSGRIGVNYLFDNGLAPYVSWSHSFQPTVGTDFAGKAFEPTTGNQYEAGLKYQPAG
GNGLLTLSTYQITQKNSLTIDPNHTLYQVQQGETRLRGVELEGRWNIGTNFTVYGDYTYS
NSKVTRSNDRPSLGKQIALLPKQQASLGADYTIVGGPLAGLGFGGGVRYVGSHYGDIYND
WKTPSYTLLDAAVHYDTGNWRFQLNVTNLTDKDYVSVCNSAYWCYYGYERTVTASARYRW