Protein Info for LRK53_RS07185 in Rhodanobacter sp000427505 FW510-R12

Annotation: nicotinate-nucleotide adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00125: cytidyltransferase-like domain
  • amino acids 10 to 65 (56 residues), 41.4 bits, E=1.3e-14
• TIGR00482: nicotinate (nicotinamide) nucleotide adenylyltransferase
  • amino acids 11 to 202 (192 residues), 125.6 bits, E=2.6e-40
• PF01467: CTP_transf_like
  • amino acids 11 to 187 (177 residues), 81.4 bits, E=3.6e-27

Best Hits

Swiss-Prot: 50% identical to NADD_DECAR: Probable nicotinate-nucleotide adenylyltransferase (nadD) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00969, nicotinate-nucleotide adenylyltransferase [EC: 2.7.7.18] (inferred from 50% identity to nhl:Nhal_0541)

Predicted SEED Role

"Nicotinate-nucleotide adenylyltransferase (EC 2.7.7.18)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.7.7.18)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis II (from tryptophan) (8/9 steps found)
• NAD salvage pathway II (PNC IV cycle) (5/5 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• NAD salvage (plants) (6/11 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.18

Protein Sequence (218 amino acids)

>LRK53_RS07185 nicotinate-nucleotide adenylyltransferase (Rhodanobacter sp000427505 FW510-R12)
MPHTANKPLAIFGGTFDPVHLGHLSVAWEAAELLDAEVRLLPASVPPHRAPPIATAAQRV
AILCAALRGQSRLTLDTRELDRSGPSFTIDTLHELRAEQGERPLVLLLGADAFAGLATWH
RWHELFGAAHLGVLSRPGVSAVLPDELEREVADRRVADASALRALPAGKLIELAVTPLEI
SATRVRELLAAGRDPRYLLPAGLFDDPALLAPYRTPAV