Protein Info for LRK53_RS07150 in Rhodanobacter sp000427505 FW510-R12

Annotation: paraquat-inducible protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 97 to 123 (27 residues), see Phobius details amino acids 136 to 163 (28 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details PF04403: PqiA" amino acids 48 to 199 (152 residues), 134.1 bits, see alignment E=2.1e-43

Best Hits

KEGG orthology group: K03808, paraquat-inducible protein A (inferred from 44% identity to pfl:PFL_4556)

Predicted SEED Role

"Paraquat-inducible protein A" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>LRK53_RS07150 paraquat-inducible protein A (Rhodanobacter sp000427505 FW510-R12)
MGTASPTTLLICEHCDTVYRRRPLGRGEVATCARCQAELERHHGLGVNALLALILTALIV
FVQANMWPIVTLGLSGQLSGTTLWGVIIAMWREQAQVVSVLVAATLFFFPLMKMAMLGWL
LWFARAGRRAPGFVRLMVALHYLGPWTMSEVFVLGALVAIVKAHAYFDVIPAPGIYAYAA
LTLLITILAGVDLRQLWDDVPERAA