Protein Info for LRK53_RS07145 in Rhodanobacter sp000427505 FW510-R12

Annotation: thioredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF00085: Thioredoxin" amino acids 11 to 112 (102 residues), 96 bits, see alignment E=3.1e-31 TIGR01068: thioredoxin" amino acids 16 to 114 (99 residues), 105.6 bits, see alignment E=6.3e-35 PF13098: Thioredoxin_2" amino acids 29 to 111 (83 residues), 34.1 bits, see alignment E=7.9e-12 PF14559: TPR_19" amino acids 134 to 193 (60 residues), 36.3 bits, see alignment E=1.4e-12 PF14561: TPR_20" amino acids 201 to 288 (88 residues), 81.1 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K05838, putative thioredoxin (inferred from 57% identity to smt:Smal_2914)

Predicted SEED Role

"FIG000875: Thioredoxin domain-containing protein EC-YbbN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>LRK53_RS07145 thioredoxin (Rhodanobacter sp000427505 FW510-R12)
MTDAATVSHVFDVDQQTFEADVLQASLTTPVLVDFWASWCGPCKTLGPMLEKLAAEYNGA
FRLGKVDVDAQKELAGMFGIRSIPTVVLVKDGQVLDGFTGALPEGQLREFLSRHVQPLEA
PAPAAEEVAVSETPEQAINRLQQAIAGEPNRPELKLDLALALMHAGNVAAAAVELAALPA
NLATDARAVRLRNELELAHAARDAPGIAELQQRVQTDPADWATRDQLGVQLLLQGDTEAG
LEQFLAILQQARDWNDGQAKKRLLAAFATLDDAELVSRYRRRMASLLF