Protein Info for LRK53_RS07125 in Rhodanobacter sp000427505 FW510-R12

Annotation: tellurite resistance/C4-dicarboxylate transporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 175 to 201 (27 residues), see Phobius details amino acids 214 to 235 (22 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details PF03595: SLAC1" amino acids 13 to 334 (322 residues), 160.9 bits, see alignment E=2.3e-51

Best Hits

KEGG orthology group: None (inferred from 43% identity to gpb:HDN1F_27170)

Predicted SEED Role

"C4-dicarboxylate transporter/malic acid transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (353 amino acids)

>LRK53_RS07125 tellurite resistance/C4-dicarboxylate transporter family protein (Rhodanobacter sp000427505 FW510-R12)
MTLADTLLQRARHLAPGSFALVMATGIVSIDTSQHGLPWVARALFAFNLLAFAWLLALSL
LRLARFRRELVTDFTHPGRGAGFLTFAAASCVLGSQCLLVVHWPWAARALAVLGALAWAL
LTYLFLAAAITTRIKPGFTRSIHGGWLVAVVATQALATLLTLLAADRPAAHTGVLFGALC
LYLLGAALYLLIITLVVYRMLFFPLRAREFTPPYWIDMGALAITTLAGSLFVLHAPAVGP
LRELVPFVKGFTLFFWATATWWIPLLVLLEIWRHGRRHVPLRYETDDWDIVFPIGMYTVG
TYALAQALQLDFLRVIPAVGIYVSLLVWVLVAGGALLRGYRGFRVDGRRRLPR