Protein Info for LRK53_RS07100 in Rhodanobacter sp000427505 FW510-R12

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 13 to 32 (20 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 355 to 380 (26 residues), see Phobius details amino acids 392 to 415 (24 residues), see Phobius details amino acids 421 to 440 (20 residues), see Phobius details PF00324: AA_permease" amino acids 13 to 438 (426 residues), 392.5 bits, see alignment E=2.7e-121 PF13520: AA_permease_2" amino acids 14 to 431 (418 residues), 113.5 bits, see alignment E=1.2e-36

Best Hits

Swiss-Prot: 52% identical to YTNA_BACSU: Uncharacterized amino acid permease YtnA (ytnA) from Bacillus subtilis (strain 168)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 56% identity to reu:Reut_B4894)

MetaCyc: 46% identical to phenylalanine:H+ symporter PheP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>LRK53_RS07100 amino acid permease (Rhodanobacter sp000427505 FW510-R12)
MSPVLQRQLTPRHITFMALGMCIGAGLFLGSASTIKLAGPSVLIAYAFGGTMIFIIMRAL
GEMAAHEPIAGSFSTYAHKYVGPLAGYITGWNYWILMMGVGIAESTAVGIYMKTWFPDTP
QWIWAFASVAMIGGLNLLAVKIYGELEFWFSLIKVLTVVAMIAGGCAMIWLGWGNGGKPI
GLSNLWTHGGWFPNGLTGMVLALPVLVFSFGGIETIGMAAAEAAQPERTIPRAVNSVIWR
ILIFYIGSLFVIMAIYPWNALDANSSPFVTTFARLGIPSAAGLINFVVITAALSSFNSTT
FSGSRMLHSLADKGQAPAAMGRLSGHGVPMRGVLVTMAFLLFGVLMNYLVPGRIFGMMMS
ILAFNTVWTWGMVLVAHWNFRRRQVQPLGFRLRLWPLSSVLCLAFLLFVWVMLGWSPDTR
VAIYVGVAWLALLTVAYYGFGIERRMRVAQA