Protein Info for LRK53_RS07030 in Rhodanobacter sp000427505 FW510-R12

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 16 to 42 (27 residues), see Phobius details amino acids 247 to 249 (3 residues), see Phobius details amino acids 252 to 279 (28 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details PF12704: MacB_PCD" amino acids 34 to 223 (190 residues), 49.4 bits, see alignment E=7e-17 PF02687: FtsX" amino acids 259 to 371 (113 residues), 42.3 bits, see alignment E=7.1e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 60% identity to xal:XALc_1771)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>LRK53_RS07030 ABC transporter permease (Rhodanobacter sp000427505 FW510-R12)
MVALARKTLVYEWRRFLPAMLAVGFAGLLQLLQIALVLGIFGSTSLYITGSSADVWVGYP
GTQSVSLGRTIDADVESRLLMDPAVQQVEPYLWVDGDWRGPRETGGVSVFVSGIDPAADA
LMFSKVLAPALRRRLAEPDAIVIDRSAMDQLGVGIGQTATINGHQVRVVGISRGLRALGG
VNVLCSLDTARRLDNDPADLGPTYLVAKLRDPTQADAVAMRLRGDTAFGPYTAWSAADFA
NISVRYWLFDTGAGAGVLFLAGIVFLVGAAITSQTLIAAVNGSVREYATLNALGVGVGAL
RKVVLEQAFWVGALGLLGASALGILLMLLARSQDVPVVLNVPAALACILLVMGLAAVSGL
AAMRSLRRADPATLLR