Protein Info for LRK53_RS07015 in Rhodanobacter sp000427505 FW510-R12

Annotation: alpha/beta fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12146: Hydrolase_4
  • amino acids 15 to 252 (238 residues), 75 bits, E=9e-25
• PF00561: Abhydrolase_1
  • amino acids 16 to 110 (95 residues), 27.9 bits, E=2.8e-10
• PF12697: Abhydrolase_6
  • amino acids 16 to 249 (234 residues), 49.5 bits, E=1.3e-16

Best Hits

KEGG orthology group: K03928, carboxylesterase [EC: 3.1.1.1] (inferred from 70% identity to smt:Smal_1188)

Predicted SEED Role

"FIG01111139: hypothetical protein"

MetaCyc Pathways

• methylsalicylate degradation (2/2 steps found)
• aspartame degradation (1/2 steps found)
• methyl indole-3-acetate interconversion (1/2 steps found)
• superpathway of methylsalicylate metabolism (1/5 steps found)
• retinol biosynthesis (1/7 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis II
• Drug metabolism - other enzymes

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.1

Use Curated BLAST to search for 3.1.1.1

Protein Sequence (278 amino acids)

>LRK53_RS07015 alpha/beta fold hydrolase (Rhodanobacter sp000427505 FW510-R12)
MIQQTDFFLEGGRSGVLLIHGLTGTPMEMKLLGKGLNNAGFTVHGMQLAGHCGNVEDLLA
TGWRDWYASVEQAADAMLDKVDQLFVGGLSMGALLALKLAAERPGRVAGVGVYGATFRYD
GWSIPKLARLSFLLPLLKKLGIGRDRSFMEQPPYGIRDERLRAQVSAAMLGGDSAAAGLP
GNPWYSLAEMYGLAADVRRRLPRVTAPCLVAHASDDDVASTKNAELVMRQVSAPTELLLL
EDSYHMITIDKQRRTLIQRSAAFFNGIAASNGTQRAAA