Protein Info for LRK53_RS06890 in Rhodanobacter sp000427505 FW510-R12

Annotation: cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 63% identical to CSD_XYLFA: Probable cysteine desulfurase (csd) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K11717, cysteine desulfurase / selenocysteine lyase [EC: 2.8.1.7 4.4.1.16] (inferred from 66% identity to xca:xccb100_1392)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), SufS subfamily" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

superpathway of L-alanine biosynthesis (4/4 steps found)
superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
L-alanine biosynthesis III (1/1 steps found)
L-cysteine degradation IV (1/1 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
molybdopterin biosynthesis (2/6 steps found)
tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
tRNA-uridine 2-thiolation and selenation (bacteria) (3/11 steps found)
[2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (414 amino acids)

>LRK53_RS06890 cysteine desulfurase (Rhodanobacter sp000427505 FW510-R12)
MNAQASTPTVFDVQRIRADFPLLARRVHDKPLVYFDNANTSQKPLSVIEAVDHHYREHNA
NVARAVHQLGEEATAAYESARDRLARFLNAPSRNEVILTTGTTQSINLVAYSYALPQLKP
GDSILTTVMEHHANIVPWQLVAARSGATVKAAPIDQRGELIVEKYVELLTPEVKLACVTH
VSNVLGTVNPVREIARECRKRGIPLLVDGSQAAPHRPVDVQALGCDFYAVTGHKMLGPTG
TGALWAKREHLEAMPPFFGGGEMIREVRFSGTTFAAPPHKFEAGTPNIAGFVGLSAAIDY
YASVGFEAIHAWEQQLLHYATERLREVPGLRIIGEAAEKEPVISFLLEGAQATDLATLLD
LQGVAVRSGHHCAHPLMQFYGVPATLRVSLAFYNTREEIDAFVVALLKVRKLLL